Strategy 9 min read

Email Marketing Retainer: What $2,000/Month Buys (2026)

Written by Excelohunt Team · Reviewed by Ravinderpal Singh · · Updated August 2, 2026
Email Marketing Retainer: What $2,000/Month Buys (2026)

You’ve been doing email marketing yourself — or relying on a basic freelancer — and you’re finally ready to invest in a proper agency retainer. You’ve seen prices ranging from $500/month to $10,000/month and you have no idea what the difference is.

This post is a frank breakdown of what a $2,000/month email marketing retainer actually includes in 2026, what you should expect to receive, and how to tell whether you’re getting real value or paying for someone to press “send” twice a week.

What Is an Email Marketing Retainer?

An email marketing retainer is a fixed monthly fee paid to an agency or specialist in exchange for ongoing email management — typically covering strategy, automation flows, campaign sends, copywriting, design, deliverability monitoring, and reporting. Unlike project pricing, a retainer buys continuous optimisation and accumulated account knowledge rather than a one-off deliverable.

Why $2,000/Month Is a Meaningful Threshold

At $500–$1,000/month, you’re typically paying for basic execution: someone to build a template, write copy, and schedule campaigns. There’s minimal strategy, no real testing, and deliverability is often an afterthought.

At $2,000/month, you’re entering full-service territory. This is where an agency can actually move the needle on your revenue — not just maintain the status quo. For a brand doing $300K–$1M/year in revenue, that retainer should be generating 3–8x its cost in attributable email revenue every month.

If it isn’t, something is wrong.

If you’re reading from outside the US: $2,000/month works out to roughly £1,600 or A$3,000 (approximate conversions, not fixed rates). For market-specific rate cards, see our guides to email marketing agency costs in the UK and email marketing agency pricing in Australia.

Retainer Pricing at a Glance

Monthly retainerWho it fitsWhat you getFull breakdown
$1,000Brands starting out with agency support~4 campaigns/month, core flows managed, monthly reportingRetainer vs project pricing
$2,000$200K–$1M/year brandsFull-service: flows built and optimised, 8–12 sends/month, copy, design, strategy callsYou’re reading it
$5,000$1M+/year, 7-figure brandsComplete flow suite, advanced segmentation, A/B testing programme, dedicated account managerWhat $5,000/month delivers
$10,000$10M–$50M/year enterprise brandsDedicated six-specialist team, 12–16 sends/month, multi-ESP management, executive reportingWhat $10,000/month includes
$20,000+$50M+, multi-brand or multi-market operationsDedicated email operations function, custom development, 24/7 deliverabilityEnterprise email at $20,000/month

For context on where we sit in that table: our own plans start at $987/month — see our pricing for what’s included at each tier.

What’s Included: The Core Deliverables

A well-structured $2,000/month retainer should include all of the following:

1. Platform Management (Klaviyo, Omnisend, or ActiveCampaign)

Your agency should fully own and manage your email platform. This means:

  • List health maintenance (suppression lists, bounce management, unengaged segment exclusions)
  • Deliverability monitoring — tracking inbox placement rates, spam complaint rates, and sender reputation
  • Integration management (Shopify sync, custom events, data layer troubleshooting)
  • Account organization: naming conventions, folder structures, archiving old flows

If your agency is just logging into Klaviyo to schedule campaigns and nothing else, you’re being underserved.

2. Core Automation Flows — Built and Optimized

At $2K/month, you should have all foundational flows built and continuously optimized, not just set-and-forget. The core flows every e-commerce brand needs:

  • Welcome series (3–5 emails, typically 7–14 days): This is your highest-ROI automation. A well-tuned welcome series should convert 5–15% of subscribers into first-time buyers.
  • Abandoned cart (2–3 email sequence): Recovering 5–10% of abandoned carts through email alone is realistic for most brands.
  • Browse abandonment (1–2 emails): Often overlooked but valuable for high-intent visitors.
  • Post-purchase series: Thank you, cross-sell, review request, replenishment reminder depending on your product category.
  • Win-back flow: Re-engaging lapsed customers who haven’t purchased in 90–180 days.

Each of these should be reviewed quarterly at minimum, with split tests running on subject lines, copy, and send timing.

3. Campaign Sends (8–12/Month)

Regular broadcast campaigns keep your list engaged and drive consistent revenue. At $2K/month you should expect 2–3 sends per week, which means:

  • Weekly promotional campaigns (sales, new arrivals, bundles)
  • Content or educational emails when appropriate for your brand
  • Segmented sends to different audience slices (VIP buyers, single-purchase customers, browse-only subscribers)

Generic blasts to your full list are a 2019 strategy. In 2026, every campaign send should at minimum be suppressing unengaged subscribers and ideally be segmented by purchase behavior or engagement tier.

4. Copywriting and Design

This is often where agencies cut corners. At $2K/month, you should receive:

  • Full copy for every campaign and flow email — not a template you fill in yourself
  • On-brand email design, either using a maintained master template or custom HTML layouts
  • Subject line and preview text written for every send (not “RE: Your order” copy-paste)
  • Mobile-optimized rendering across Gmail, Apple Mail, Outlook

If you’re writing your own copy or briefing a junior VA to do it, you’re not getting a full-service retainer.

5. Monthly Reporting and Strategy Calls

A real agency should be reporting on:

  • Revenue attributed to email (campaigns vs. flows breakdown)
  • List growth rate and source breakdown
  • Open rates, click rates, and conversion rates benchmarked against your category
  • Deliverability metrics (inbox placement, spam complaints)
  • Test results and what’s being changed based on data

You should have a 30–60 minute call monthly to review results, align on upcoming promotions, and discuss strategy. If your agency only communicates via Slack and you haven’t spoken to a strategist in 2 months, that’s a red flag.

What’s Usually NOT Included at $2,000/Month

Being clear about scope matters. At this price point, you typically won’t get:

  • SMS marketing: SMS management (via Klaviyo SMS, Postscript, or Attentive) is usually a separate add-on — often $500–$1,000/month more depending on volume.
  • List building strategy: Landing page design, pop-up optimization, and paid list growth campaigns are typically outside scope unless specifically agreed.
  • Paid email acquisition: Facebook/Meta lead gen campaigns to grow your email list aren’t part of email management.
  • Advanced custom development: Complex custom integrations or bespoke HTML coding beyond standard templates.

Some agencies bundle these; most don’t. Ask specifically what’s in scope before signing.

Agency vs. Freelancer: The Real Difference at $2K/Month

A freelancer charging $2,000/month is typically one person doing everything — strategy, design, copy, and execution. When they get sick, go on holiday, or land a bigger client, you feel it. There’s no backup, no peer review, and usually limited strategic depth.

An agency at $2,000/month should have a dedicated strategist overseeing your account, a copywriter, and a designer — even if these roles have overlap. The account is not dependent on a single person, and there’s institutional knowledge built up over time.

The other key difference: agencies working with 20–50 e-commerce brands in parallel have benchmarks and pattern recognition that a solo freelancer simply can’t develop. When we at Excelohunt see a client’s welcome series converting at 3% we know immediately that’s below par — because we see what “good” looks like across dozens of similar accounts.

Signs You’re Getting Good Value from Your Retainer

  • Email is driving 20–35% of your total store revenue (check Klaviyo’s attribution dashboard)
  • Your abandoned cart flow has a 5%+ conversion rate
  • Your sender reputation score in Google Postmaster is “High”
  • You receive proactive recommendations, not just execution of what you ask for
  • Your list is growing month over month without you doing anything special

Signs You’re Not Getting Value

  • Your agency sends campaigns but has never mentioned deliverability
  • Flows were built once on day one and haven’t been touched
  • Monthly reporting is a screenshot of the Klaviyo dashboard with no analysis
  • You don’t know what your email revenue attribution is
  • Your agency responds to briefs but never initiates ideas

The Right Investment Level for Your Brand

For brands doing $200K–$1M/year in revenue, a $2,000/month email retainer is the sweet spot. You’re investing enough to get real expertise and consistent execution, but you’re not overinvesting relative to your scale.

At $500K+ ARR, you should be pushing toward $3,000–$5,000/month to unlock advanced segmentation, more campaign sends, dedicated reporting, and potentially SMS integration.

At $1M+ ARR, email marketing is a significant revenue driver and should be treated as such — $5,000–$10,000/month with a senior strategist is appropriate.

Frequently Asked Questions

How much does an email marketing retainer cost?

Email marketing retainers range from around $1,000/month at the starter tier (basic execution: a handful of campaigns and managed core flows) up to $20,000+/month for enterprise multi-brand operations. $2,000/month is where full-service begins — flows built and optimised, 8–12 campaign sends, copywriting, design, and monthly strategy. Below $1,000/month you’re typically paying for scheduling, not strategy.

Is an email marketing retainer worth it?

At $2,000/month, a retainer should generate 3–8x its cost in attributable email revenue every month for a brand doing $300K–$1M/year. The broader benchmark: email should drive 20–35% of total store revenue. If you’re paying for a retainer and email is under 15% of revenue — or you don’t know the number — the retainer isn’t earning its keep.

Should I choose a retainer or project pricing?

Choose a retainer if you send consistently (4+ campaigns per month) and want your automation stack continuously optimised rather than built once. Choose project pricing for a defined one-off need — an audit, an ESP setup, a single flow build — or if you’re early stage and not ready for a monthly commitment. Many brands start with a project, then move to a retainer once the infrastructure is in place.


If you’re currently spending $2,000/month and email is driving less than 15% of your revenue — or you’re not sure what that number is — something is wrong. At Excelohunt, we work with growing e-commerce brands at the $2K–$5K/month range and our benchmark is 25–40% email revenue attribution for brands in the $300K–$2M ARR range.

Get a free email marketing audit →

We’ll review your Klaviyo (or equivalent) account, identify what’s underperforming, and give you a clear picture of what $2,000/month should be delivering for a brand at your stage.

Tags: email-marketingretaineragencypricingklaviyo

Want Us to Implement This for Your Brand?

Get a free email audit and see exactly where you're losing revenue.

Get Your Free Audit
1